PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00050.1_g00039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 414aa    MW: 46403.8 Da    PI: 5.0437
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00050.1_g00039.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.33.7e-091356340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                             +r C+ + +k+++++C  ++ +lC++C +  H+       H++v
  Rsa1.0_00050.1_g00039.1 13 ARACDSCVKKRARWYCAADDAFLCQSCDTLVHSAnplarrHERV 56
                             578*****************************657888888876 PP

2CCT68.12.4e-23356399144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Rsa1.0_00050.1_g00039.1 356 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 399
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.9E-101158IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8791158IPR000315B-box-type zinc finger
PfamPF006434.5E-81356IPR000315B-box-type zinc finger
CDDcd000211.50E-91458No hitNo description
PfamPF062036.8E-18356398IPR010402CCT domain
PROSITE profilePS5101716.083356398IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MKSVANAVGA KTARACDSCV KKRARWYCAA DDAFLCQSCD TLVHSANPLA RRHERVRLKS  60
ASPAVSKYTN HNHSPSSPPH EAATWHQGFT RKPRTPRGSG KKNNLSIFHD LVPEISAEDQ  120
TDSYEIEEQL ICQVPVLDPM VAEQFLNDVV EPKIEFPLMR IDDQENEDNA ESCLNGFFPT  180
DMELEEFAAD VETLLGHGLD VTESYAMEGL GLSNTEMFKI EKDEIEEDEG EETKAMNMGI  240
GCGEDRDDGD GTVAFELRFD HESHNTYEEE AIKNVECIKV KEEEQKNVLM LSLNYDSVIS  300
TWGGQGPPWT SGEPPERDID ISDKPVVSME INGGESHHKH YVGGCLPSTG FGDGGREARV  360
SRYREKRRTR LFSKKIRYEV RKLNAEKRPR MKGRFVKRAS LALSAANSPL GVNY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366382RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587109.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0D3CD730.0A0A0D3CD73_BRAOL; Uncharacterized protein
STRINGBra024750.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain